Recombinant Human Interleukin-13 (IL13), partial (Active)

Product Description

Recombinant Human Interleukin-13 (IL13), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL13

Alternative Names : Interleukin-13;IL-13;

Expression Region : 25-146aa

AA Sequence : LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 14.3 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 5 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.

Function : Cytokine

Involvement in disease : Allergic rhinitis (ALRH)

Subcellular location : Secreted

Protein Families : IL-4/IL-13 family

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P35225