Recombinant Human Junctional adhesion molecule B (JAM2), partial

Product Description

Recombinant Human Junctional adhesion molecule B (JAM2), partial is available at Gentaur for Next week Delivery.

Gene Name: JAM2

Alternative Names : Junctional adhesion molecule 2;JAM-2Vascular endothelial junction-associated molecule;VE-JAM; CD322

Expression Region : 29-238aa

AA Sequence : FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in the processes of lymphocyte homing to secondary lymphoid organs.

Function : May play a role in the processes of lymphocyte homing to secondary lymphoid organs.

Involvement in disease :

Subcellular location : Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily

Tissue Specificity : Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.

Paythway : Leukocytetransendothelialmigration

Uniprot ID : P57087