Euro
British Pound
US Dollar
Product Description
Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) is available at Gentaur for Next week Delivery.
Gene Name: CT83
Alternative Names : Cancer/testis antigen 83
Expression Region : 1-113aa
AA Sequence : MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type II membrane protein
Protein Families :
Tissue Specificity : Specifically expressed in testis. Expressed by cancer cell lines.
Paythway :
Uniprot ID : Q5H943
