Product Description
Recombinant Human L-lactate dehydrogenase C chain (LDHC), partial is available at Gentaur for Next week Delivery.
Gene Name: LDHC
Alternative Names : Cancer/testis antigen 32 Short name: CT32 LDH testis subunit LDH-X
Expression Region : 2-332aa
AA Sequence : STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 38.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Possible role in sperm motility.
Function : Possible role in sperm motility.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : LDH/MDH superfamily, LDH family
Tissue Specificity :
Paythway : Glucagonsignalingpathway
Uniprot ID : P07864
Euro
British Pound
US Dollar