Recombinant Human L-lactate dehydrogenase C chain (LDHC), partial

Product Description

Recombinant Human L-lactate dehydrogenase C chain (LDHC), partial is available at Gentaur for Next week Delivery.

Gene Name: LDHC

Alternative Names : Cancer/testis antigen 32 Short name: CT32 LDH testis subunit LDH-X

Expression Region : 2-332aa

AA Sequence : STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 38.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possible role in sperm motility.

Function : Possible role in sperm motility.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : LDH/MDH superfamily, LDH family

Tissue Specificity :

Paythway : Glucagonsignalingpathway

Uniprot ID : P07864