Recombinant Human Leukocyte-specific transcript 1 protein (LST1)

Product Description

Recombinant Human Leukocyte-specific transcript 1 protein (LST1) is available at Gentaur for Next week Delivery.

Gene Name: LST1

Alternative Names : Protein B144

Expression Region : 1-66aa

AA Sequence : MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Sequence Info : Full Length of Isoform 10

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Function : Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Involvement in disease :

Subcellular location : Membrane, Single-pass membrane protein, Golgi apparatus membrane, Single-pass membrane protein, Endomembrane system, Single-pass membrane protein

Protein Families : LST1 family

Tissue Specificity : Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.

Paythway :

Uniprot ID : O00453