Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Product Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: FCGR3A

Alternative Names : Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3

Expression Region : 17-208aa

AA Sequence : GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Sequence Info : Extracellular Domain

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 22.61 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.2

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptors for the Fc region of immunoglobin G (Fc?R) are divided into three classes and Fc?RIII is a multifunctional, low/intermediate affinity receptor. In humans, Fc?RIII is expressed as two distinct forms (Fc?RIIIA and Fc?RIIIB) that are encoded by two different but highly homologous genes in a cell type-specific manner. Fc?RIIIB is a low-affinity, GPI-linked receptor expressed by neutrophils and eosinophils, whereas Fc?RIIIA is an intermediate affinity polypeptide-anchored transmembrane glycoprotein expressed by a subset of T lymphocytes, natural killer (NK) cells, monocytes, and macrophages. The Fc?RIIIA receptor is involved in phagocytosis, secretion of enzymes, inflammatory mediators, antibody-dependent cellular cytotoxicity (ADCC), mast cell degranulation, and clearance of immune complexes. Fc?RIIIA has an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain and delivers an activation signal in the immune responses. Aberrant expression or mutations in this gene is implicated in susceptibility to recurrent viral infections, systemic lupus erythematosus, and alloimmune neonatal neutropenia. In humans, it is a 50 -70 kD type I transmembrane activating receptor. The Fc?RIIIA cDNA encodes 254 amino acid including a 16aa signal sequence, 191 amino acid ECD with two C2-type Ig-like domains, five potential N-glycosylation sites, a 22 amino acid transmembrane sequence and a 25 amino acid cytoplasmic domain.

Function : Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.

Involvement in disease : Immunodeficiency 20 (IMD20)

Subcellular location : Cell membrane, Single-pass type I membrane protein, Secreted

Protein Families :

Tissue Specificity : Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.

Paythway : FcgammaR-mediatedphagocytosis

Uniprot ID : P08637