Product Description
Recombinant Human Low molecular weight phosphotyrosine protein phosphatase (ACP1) is available at Gentaur for Next week Delivery.
Gene Name: ACP1
Alternative Names : Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2) Red cell acid phosphatase 1
Expression Region : 1-158aa
AA Sequence : MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Sequence Info : Full Length
Tag Info : Tag-Free
Theoretical MW : 18 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Function : Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Low molecular weight phosphotyrosine protein phosphatase family
Tissue Specificity : T-lymphocytes express only isoform 2.
Paythway :
Uniprot ID : P24666
Euro
British Pound
US Dollar