Recombinant Human Low molecular weight phosphotyrosine protein phosphatase (ACP1)

Product Description

Recombinant Human Low molecular weight phosphotyrosine protein phosphatase (ACP1) is available at Gentaur for Next week Delivery.

Gene Name: ACP1

Alternative Names : Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2) Red cell acid phosphatase 1

Expression Region : 1-158aa

AA Sequence : MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Sequence Info : Full Length

Tag Info : Tag-Free

Theoretical MW : 18 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Function : Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Low molecular weight phosphotyrosine protein phosphatase family

Tissue Specificity : T-lymphocytes express only isoform 2.

Paythway :

Uniprot ID : P24666