Recombinant Human Lymphotactin protein (XCL1)

Product Description

Recombinant Human Lymphotactin protein (XCL1) is available at Gentaur for Next week Delivery.

Gene Name: XCL1

Alternative Names : ATACC motif chemokine 1Cytokine SCM-1Lymphotaxin;SCM-1-alpha;Small-inducible cytokine C1XC chemokine ligand 1

Expression Region : 22-114aa

AA Sequence : VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chotactic activity for lymphocytes but not for monocytes or neutrophils.

Function : Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine gamma family

Tissue Specificity : Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.

Paythway : Chemokinesignalingpathway

Uniprot ID : P47992