Product Description
Recombinant Human Lymphotactin protein (XCL1) is available at Gentaur for Next week Delivery.
Gene Name: XCL1
Alternative Names : ATACC motif chemokine 1Cytokine SCM-1Lymphotaxin;SCM-1-alpha;Small-inducible cytokine C1XC chemokine ligand 1
Expression Region : 22-114aa
AA Sequence : VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Chotactic activity for lymphocytes but not for monocytes or neutrophils.
Function : Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine gamma family
Tissue Specificity : Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
Paythway : Chemokinesignalingpathway
Uniprot ID : P47992
Euro
British Pound
US Dollar