Recombinant Human MAP3K7 C-terminal-like protein (MAP3K7CL)

Product Description

Recombinant Human MAP3K7 C-terminal-like protein (MAP3K7CL) is available at Gentaur for Next week Delivery.

Gene Name: MAP3K7CL

Alternative Names : TAK1-like protein

Expression Region : 1-142aa

AA Sequence : MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS

Sequence Info : Full Length of Isoform D

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 32.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and prostatic adenocarcinoma PC3.

Paythway :

Uniprot ID : P57077