Recombinant Human Metalloreductase STEAP1 (STEAP1)

Product Description

Recombinant Human Metalloreductase STEAP1 (STEAP1) is available at Gentaur for Next week Delivery.

Gene Name: STEAP1

Alternative Names : Six-transmembrane epithelial antigen of prostate 1

Expression Region : 1-339aa

AA Sequence : MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged

Theoretical MW : 58.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor

Function : Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity).

Involvement in disease :

Subcellular location : Endosome membrane, Multi-pass membrane protein

Protein Families : STEAP family

Tissue Specificity : Ubiquitously expressed. Highly expressed in prostate tumors.

Paythway :

Uniprot ID : Q9UHE8