Recombinant Human Mitochondrial carnitine/acylcarnitine carrier protein (SLC25A20)

Product Description

Recombinant Human Mitochondrial carnitine/acylcarnitine carrier protein (SLC25A20) is available at Gentaur for Next week Delivery.

Gene Name: SLC25A20

Alternative Names : Carnitine/acylcarnitine translocase

Expression Region : 1-301aa

AA Sequence : MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 59.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Function : Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Involvement in disease : Carnitine-acylcarnitine translocase deficiency (CACTD)

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity :

Paythway :

Uniprot ID : O43772