Recombinant Human Mitochondrial fission process protein 1 (MTFP1)

Product Description

Recombinant Human Mitochondrial fission process protein 1 (MTFP1) is available at Gentaur for Next week Delivery.

Gene Name: MTFP1

Alternative Names : Mitochondrial 18KDA protein

Expression Region : 1-166aa

AA Sequence : MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 45 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.

Function : Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : MTFP1 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9UDX5