Recombinant Human Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23)

Product Description

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23) is available at Gentaur for Next week Delivery.

Gene Name: TIMM23

Alternative Names :

Expression Region : 1-209aa

AA Sequence : MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 48.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Function : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Tim17/Tim22/Tim23 family

Tissue Specificity :

Paythway :

Uniprot ID : O14925