Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40)

Product Description

Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40) is available at Gentaur for Next week Delivery.

Gene Name: TOMM40

Alternative Names : Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5

Expression Region : 1-361aa

AA Sequence : MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 64.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication

Function : Channel-forming protein essential for import of protein precursors into mitochondria.

Involvement in disease :

Subcellular location : Mitochondrion outer membrane, Multi-pass membrane protein

Protein Families : Tom40 family

Tissue Specificity :

Paythway :

Uniprot ID : O96008