Recombinant Human Mitochondrial intermembrane space import and assembly protein 40 (CHCHD4)

Product Description

Recombinant Human Mitochondrial intermembrane space import and assembly protein 40 (CHCHD4) is available at Gentaur for Next week Delivery.

Gene Name: CHCHD4

Alternative Names : Coiled-coil-helix-coiled-coil-helix domain-containing protein 4

Expression Region : 1-142aa

AA Sequence : MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 32 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermbrane space (IMS). Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS. Reduced CHCHD4/MIA40 is then reoxidized by GFER/ERV1 via a disulfide relay syst.

Function : Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17 or MICU1

Involvement in disease :

Subcellular location : Mitochondrion intermembrane space

Protein Families :

Tissue Specificity : Expressed in all tissues tested, suggesting an ubiquitous expression.

Paythway :

Uniprot ID : Q8N4Q1