Product Description
Recombinant Human Molybdopterin synthase catalytic subunit (MOCS2) is available at Gentaur for Next week Delivery.
Gene Name: MOCS2
Alternative Names : MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B
Expression Region : 1-188aa
AA Sequence : MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 47.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.
Function : Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.
Involvement in disease : Molybdenum cofactor deficiency, complementation group B (MOCODB)
Subcellular location : Cytoplasm, cytosol
Protein Families : MoaE family, MOCS2B subfamily
Tissue Specificity : Highest levels are found in heart and skeletal muscle. Lower levels are present in brain, kidney and pancreas. Very low levels are found in lung and peripheral blood leukocytes.
Paythway :
Uniprot ID : O96007
Euro
British Pound
US Dollar