Recombinant Human Monocyte differentiation antigen CD14 (CD14), partial

Product Description

Recombinant Human Monocyte differentiation antigen CD14 (CD14), partial is available at Gentaur for Next week Delivery.

Gene Name: CD14

Alternative Names : Myeloid cell-specific leucine-rich glycoprotein; CD14

Expression Region : 20-345aa

AA Sequence : TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 62.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

Function : Coreceptor for bacterial lipopolysaccharide

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Secreted, Membrane raft, Golgi apparatus

Protein Families :

Tissue Specificity : Detected on macrophages (at protein level) (PubMed:1698311). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages.

Paythway : MAPKsignalingpathway

Uniprot ID : P08571