Product Description
Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial is available at Gentaur for Next week Delivery.
Gene Name: MORC3
Alternative Names : Nuclear matrix protein 21 Zinc finger CW-type coiled-coil domain protein 3
Expression Region : 1-290aa
AA Sequence : MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 48.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).
Function : Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism
Involvement in disease :
Subcellular location : Nucleus, nucleoplasm, Nucleus matrix, Nucleus, PML body
Protein Families :
Tissue Specificity : Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney.
Paythway :
Uniprot ID : Q14149
Euro
British Pound
US Dollar