Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial

Product Description

Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial is available at Gentaur for Next week Delivery.

Gene Name: MORC3

Alternative Names : Nuclear matrix protein 21 Zinc finger CW-type coiled-coil domain protein 3

Expression Region : 1-290aa

AA Sequence : MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 48.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).

Function : Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism

Involvement in disease :

Subcellular location : Nucleus, nucleoplasm, Nucleus matrix, Nucleus, PML body

Protein Families :

Tissue Specificity : Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney.

Paythway :

Uniprot ID : Q14149