Recombinant Human N (6)-adenine-specific DNA methyltransferase 2 (N6AMT2)

Product Description

Recombinant Human N (6)-adenine-specific DNA methyltransferase 2 (N6AMT2) is available at Gentaur for Next week Delivery.

Gene Name: N6AMT2

Alternative Names : N(6)-adenine-specific DNA methyltransferase 2

Expression Region : 2-214aa

AA Sequence : SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 40.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that methylates elongation factor 1-alpha.

Function : Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Class I-like SAM-binding methyltransferase superfamily, EFM5 family

Tissue Specificity :

Paythway :

Uniprot ID : Q8WVE0