Recombinant Human Nephrin (NPHS1), partial

Product Description

Recombinant Human Nephrin (NPHS1), partial is available at Gentaur for Next week Delivery.

Gene Name: NPHS1

Alternative Names : Renal glomerulus-specific cell adhesion receptor

Expression Region : 23-257aa

AA Sequence : QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEW

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 27.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion

Function : Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion (By similarity).

Involvement in disease : Nephrotic syndrome 1 (NPHS1)

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily

Tissue Specificity : Specifically expressed in podocytes of kidney glomeruli.

Paythway :

Uniprot ID : O60500