Product Description
Recombinant Human Nephrin (NPHS1), partial is available at Gentaur for Next week Delivery.
Gene Name: NPHS1
Alternative Names : Renal glomerulus-specific cell adhesion receptor
Expression Region : 23-257aa
AA Sequence : QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEW
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 27.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion
Function : Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion (By similarity).
Involvement in disease : Nephrotic syndrome 1 (NPHS1)
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families : Immunoglobulin superfamily
Tissue Specificity : Specifically expressed in podocytes of kidney glomeruli.
Paythway :
Uniprot ID : O60500
 Euro
            
 British Pound
            
 US Dollar