Recombinant Human Neutrophil defensin 1 (DEFA1)

Product Description

Recombinant Human Neutrophil defensin 1 (DEFA1) is available at Gentaur for Next week Delivery.

Gene Name: DEFA1

Alternative Names : Defensin, alpha 1 HNP-1

Expression Region : 1-94aa

AA Sequence : MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 37.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Function : Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Alpha-defensin family

Tissue Specificity :

Paythway :

Uniprot ID : P59665