Recombinant Human Olfactory receptor 1A1 (OR1A1)

Product Description

Recombinant Human Olfactory receptor 1A1 (OR1A1) is available at Gentaur for Next week Delivery.

Gene Name: OR1A1

Alternative Names : Olfactory receptor 17-7

Expression Region : 1-309aa

AA Sequence : MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 50.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Odorant receptor.

Function : Odorant receptor.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9P1Q5