Euro
British Pound
US Dollar
Product Description
Recombinant Human Orexin receptor type 2 (HCRTR2), partial is available at Gentaur for Next week Delivery.
Gene Name: HCRTR2
Alternative Names : Hypocretin receptor type 2
Expression Region : 1-75aa
AA Sequence : MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 10.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides.
Function : Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : G-protein coupled receptor 1 family
Tissue Specificity :
Paythway :
Uniprot ID : O43614
