Recombinant Human Parathyroid hormone (PTH) (Active)

Product Description

Recombinant Human Parathyroid hormone (PTH) (Active) is available at Gentaur for Next week Delivery.

Gene Name: PTH

Alternative Names : Parathyroid Hormone; PTH; Parathormone; Parathyrin

Expression Region : 32-115aa

AA Sequence : SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 9 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce cAMP accumulation in MC3T3?E1 mouse preosteoblast cells is less than 0.1 ug/ml

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids.

Function : PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.

Involvement in disease : Hypoparathyroidism, familial isolated (FIH)

Subcellular location : Secreted

Protein Families : Parathyroid hormone family

Tissue Specificity :

Paythway :

Uniprot ID : P01270