Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA)

Product Description

Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA) is available at Gentaur for Next week Delivery.

Gene Name: PPIA

Alternative Names : Cyclophilin ACyclosporin A-binding proteinRotamase A

Expression Region : 1-165aa

AA Sequence : MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 23.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Function : PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Involvement in disease :

Subcellular location : Cytoplasm, Secreted

Protein Families : Cyclophilin-type PPIase family, PPIase A subfamily

Tissue Specificity :

Paythway : Necroptosis

Uniprot ID : P62937