Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3 (FKBP3)

Product Description

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3 (FKBP3) is available at Gentaur for Next week Delivery.

Gene Name: FKBP3

Alternative Names : 25KDA FK506-binding protein;25KDA FKBP;FKBP-25FK506-binding protein 3;FKBP-3Immunophilin FKBP25Rapamycin-selective 25KDA immunophilinRotamase

Expression Region : 2-224aa

AA Sequence : AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 41 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins.

Function : FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : FKBP-type PPIase family

Tissue Specificity :

Paythway :

Uniprot ID : Q00688