Product Description
Recombinant Human PHD finger protein 11 (PHF11) is available at Gentaur for Next week Delivery.
Gene Name: PHF11
Alternative Names : BRCA1 C-terminus-associated protein Renal carcinoma antigen NY-REN-34
Expression Region : 1-292aa
AA Sequence : MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY
Sequence Info : Full Length of Isoform 2
Tag Info : N-terminal GST-tagged
Theoretical MW : 60.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Positive regulator of Th1-type cytokine gene expression.
Function : Positive regulator of Th1-type cytokine gene expression.
Involvement in disease :
Subcellular location : Nucleus
Protein Families :
Tissue Specificity : Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small intestine, breast, liver and placenta.
Paythway :
Uniprot ID : Q9UIL8
Euro
British Pound
US Dollar