Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB)

Product Description

Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB) is available at Gentaur for Next week Delivery.

Gene Name: GP1BB

Alternative Names : Antigen CD42b-beta CD_antigen: CD42c

Expression Region : 26-206aa

AA Sequence : CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 39.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Function : Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Involvement in disease : Bernard-Soulier syndrome (BSS)

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Expressed in heart and brain.

Paythway : Hematopoieticcelllineage

Uniprot ID : P13224