Recombinant Human Poliovirus receptor (PVR), partial

Product Description

Recombinant Human Poliovirus receptor (PVR), partial is available at Gentaur for Next week Delivery.

Gene Name: PVR

Alternative Names : Nectin-like protein 5 Short name: NECL-5 CD_antigen: CD155

Expression Region : 21-343aa

AA Sequence : WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 51.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.

Function : Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors

Involvement in disease :

Subcellular location : Isoform Alpha: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform Delta: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform Beta: Secreted, SUBCELLULAR LOCATION: Isoform Gamma: Secreted

Protein Families : Nectin family

Tissue Specificity :

Paythway :

Uniprot ID : P15151