Product Description
Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial is available at Gentaur for Next week Delivery.
Gene Name: ATP4B
Alternative Names : Gastric H(+)/K(+) ATPase subunit betaProton pump beta chain
Expression Region : 58-291
AA Sequence : CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 28.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Function : Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type II membrane protein
Protein Families : X(+)/potassium ATPases subunit beta family
Tissue Specificity :
Paythway : OxidativePhosphorylation
Uniprot ID : P51164