Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial

Product Description

Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial is available at Gentaur for Next week Delivery.

Gene Name: ATP4B

Alternative Names : Gastric H(+)/K(+) ATPase subunit betaProton pump beta chain

Expression Region : 58-291

AA Sequence : CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

Function : Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type II membrane protein

Protein Families : X(+)/potassium ATPases subunit beta family

Tissue Specificity :

Paythway : OxidativePhosphorylation

Uniprot ID : P51164