Recombinant Human Pro-epidermal growth factor (EGF), partial (Active)

Product Description

Recombinant Human Pro-epidermal growth factor (EGF), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: EGF

Alternative Names : Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone

Expression Region : 971-1023aa

AA Sequence : NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 6.2 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by the dose-dependent proliferation of murine BALB/c 3T3 cells is typically 0.1-0.5 ng/ml

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Epidermal growth factor (EGF) is a small 53 amino acid residue long protein that contains three disulfide bridges. It is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites.

Function : EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro

Involvement in disease : Hypomagnesemia 4 (HOMG4)

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Expressed in kidney, salivary gland, cerebrum and prostate.

Paythway : ErbBsignalingpathway

Uniprot ID : P01133