Recombinant Human Pro-epidermal growth factor (EGF) , partial

Product Description

Recombinant Human Pro-epidermal growth factor (EGF) , partial is available at Gentaur for Next week Delivery.

Gene Name: EGF

Alternative Names : Urogastrone

Expression Region : 977-1023

AA Sequence : PLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 32.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagent of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro .

Function : EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro

Involvement in disease : Hypomagnesemia 4 (HOMG4)

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Expressed in kidney, salivary gland, cerebrum and prostate.

Paythway : ErbBsignalingpathway

Uniprot ID : P01133