Recombinant Human Probetacellulin (BTC)

Product Description

Recombinant Human Probetacellulin (BTC) is available at Gentaur for Next week Delivery.

Gene Name: BTC

Alternative Names :

Expression Region : 32-178aa

AA Sequence : DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Function : Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Involvement in disease :

Subcellular location : Betacellulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Probetacellulin: Cell membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.

Paythway : ErbBsignalingpathway

Uniprot ID : P35070