Recombinant Human Protein BEX3 (NGFRAP1)

Product Description

Recombinant Human Protein BEX3 (NGFRAP1) is available at Gentaur for Next week Delivery.

Gene Name: NGFRAP1

Alternative Names : Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor

Expression Region : 1-111aa

AA Sequence : MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Apoptosis

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.

Function : May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm

Protein Families : BEX family

Tissue Specificity : Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.

Paythway : Neurotrophinsignalingpathway

Uniprot ID : Q00994