Recombinant Human Protein DGCR6L (DGCR6L)

Product Description

Recombinant Human Protein DGCR6L (DGCR6L) is available at Gentaur for Next week Delivery.

Gene Name: DGCR6L

Alternative Names : DiGeorge syndrome critical region 6-like protein

Expression Region : 1-220aa

AA Sequence : MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 40.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.

Function : May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Gonadal family

Tissue Specificity : Widely expressed in fetal and adult tissues. Highest expression in liver, heart and skeletal muscle. Lower levels in pancreas and placenta. Weak expression in brain.

Paythway :

Uniprot ID : Q9BY27