Recombinant Human Protein S100-A11 (S100A11)

Product Description

Recombinant Human Protein S100-A11 (S100A11) is available at Gentaur for Next week Delivery.

Gene Name: S100A11

Alternative Names : Calgizzarin;Metastatic lymph node gene 70 protein;MLN 70Protein S100-CS100 calcium-binding protein A11

Expression Region : 2-105aa

AA Sequence : AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 27.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Facilitates the differentiation and the cornification of keratinocytes.

Function : Facilitates the differentiation and the cornification of keratinocytes.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : S-100 family

Tissue Specificity :

Paythway :

Uniprot ID : P31949