Recombinant Human Protein S100-A7A (S100A7A), partial

Product Description

Recombinant Human Protein S100-A7A (S100A7A), partial is available at Gentaur for Next week Delivery.

Gene Name: S100A7A

Alternative Names : S100 calcium-binding protein A15S100 calcium-binding protein A7-like 1S100 calcium-binding protein A7A

Expression Region : 2-101aa

AA Sequence : SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.

Function : May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : S-100 family

Tissue Specificity : Overexpressed in psoriasis.

Paythway :

Uniprot ID : Q86SG5