Euro
British Pound
US Dollar
Product Description
Recombinant Human Protein yippee-like 3 (YPEL3) is available at Gentaur for Next week Delivery.
Gene Name: YPEL3
Alternative Names :
Expression Region : 1-119aa
AA Sequence : MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 29.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in proliferation and apoptosis in myeloid precursor cells.
Function : Involved in proliferation and apoptosis in myeloid precursor cells.
Involvement in disease :
Subcellular location : Nucleus, nucleolus
Protein Families : Yippee family
Tissue Specificity : Widely expressed.
Paythway :
Uniprot ID : P61236
