Product Description
Recombinant Human Prothymosin alpha (PTMA) is available at Gentaur for Next week Delivery.
Gene Name: PTMA
Alternative Names : TMSA
Expression Region : 1-111aa
AA Sequence : MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 14.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Function : Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : Pro/parathymosin family
Tissue Specificity :
Paythway :
Uniprot ID : P06454
Euro
British Pound
US Dollar