Product Description
Recombinant Human Pterin-4-alpha-carbinolamine dehydRatase (PCBD1) is available at Gentaur for Next week Delivery.
Gene Name: PCBD1
Alternative Names : 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alpha;DCoH;Dimerization cofactor of HNF1;Phenylalanine hydroxylase-stimulating protein;Pterin carbinolamine dehydratase;PCD
Expression Region : 2-104aa
AA Sequence : AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 13.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Function : Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Involvement in disease : Hyperphenylalaninemia, BH4-deficient, D (HPABH4D)
Subcellular location : Cytoplasm, Nucleus
Protein Families : Pterin-4-alpha-carbinolamine dehydratase family
Tissue Specificity :
Paythway :
Uniprot ID : P61457
Euro
British Pound
US Dollar