Product Description
Recombinant Human Pyridoxal kinase (PDXK) is available at Gentaur for Next week Delivery.
Gene Name: PDXK
Alternative Names : Pyridoxine kinase
Expression Region : 1-312aa
AA Sequence : MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 62.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
Function : Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Pyridoxine kinase family
Tissue Specificity : Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.
Paythway :
Uniprot ID : O00764
Euro
British Pound
US Dollar