Recombinant Human Pyridoxal kinase (PDXK)

Product Description

Recombinant Human Pyridoxal kinase (PDXK) is available at Gentaur for Next week Delivery.

Gene Name: PDXK

Alternative Names : Pyridoxine kinase

Expression Region : 1-312aa

AA Sequence : MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 62.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for synthesis of pyridoxal-5-phosphate from vitamin B6.

Function : Required for synthesis of pyridoxal-5-phosphate from vitamin B6.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Pyridoxine kinase family

Tissue Specificity : Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.

Paythway :

Uniprot ID : O00764