Recombinant Human Ras-related protein Rab-18 (RAB18)

Product Description

Recombinant Human Ras-related protein Rab-18 (RAB18) is available at Gentaur for Next week Delivery.

Gene Name: RAB18

Alternative Names :

Expression Region : 1-206aa

AA Sequence : MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 49.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Function : Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Involvement in disease : Warburg micro syndrome 3 (WARBM3)

Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side

Protein Families : Small GTPase superfamily, Rab family

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : Q9NP72