Product Description
Recombinant Human Ribonucleoprotein PTB-binding 2 (RAVER2), partial is available at Gentaur for Next week Delivery.
Gene Name: RAVER2
Alternative Names : Protein raver-2
Expression Region : 1-140aa
AA Sequence : MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 17 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May bind single-stranded nucleic acids.Curated
Function : May bind single-stranded nucleic acids.
Involvement in disease :
Subcellular location : Nucleus, Cytoplasm
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q9HCJ3