Recombinant Human RNA exonuclease 4 (REXO4)

Product Description

Recombinant Human RNA exonuclease 4 (REXO4) is available at Gentaur for Next week Delivery.

Gene Name: REXO4

Alternative Names : Exonuclease XPMC2 Prevents mitotic catastrophe 2 protein homolog Short name: hPMC2

Expression Region : 1-422aa

AA Sequence : MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 60.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Nucleus, nucleolus

Protein Families : REXO4 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9GZR2